CAT# | AF3204 |
Sequence | KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYPK |
Activity | Cancer cells |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
What is GIP? GIP (Gastric Inhibitory Polypeptide or Glucose-dependent Insulinotropic Peptide) is a peptide hormone composed ...
MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...