CAT# | A40009 |
Sequence | YCNKKTSCRSCALDQNCQWEPRNQECIALPENICGIGWHL |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...
Growth hormone releasing factor (GRF) (human) acetate is an acetate salt of an amidated synthetic 29-amino acid ...
Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...