CAT# | V02012 |
M.F/Formula | C136H216N36O40 |
M.W/Mr. | 2995.43 |
Sequence | HADGVFTSDFSRLLGQLSAKKYLESLI-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...
Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...
Glucagon is a 29-amino acid peptide hormone that is synthesized in pancreatic α cells from the proglucagon precursor by proho ...
Tertiapin-Q (TPN-Q) is a small compact protein that contains twenty-one amino acids, which derived from bee veno ...