CAT# | AF2423 |
Sequence | GRRKRQMEARFEPQNRNYRKRELDLEKLFANMPDY |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The thymopentin is a small peptide consisting of 5 amino acid residues (Arg-Lys-Asp-Val-Tyr) from thymosin. It h ...
Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...
Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...
In the respiratory tract, there are tachykinin P (SP) and neurokinin A (NKA) in capsaicin-sensitive primary affe ...