Keywords Search Google Search Search

LL-37, Antimicrobial Peptide, human

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	L07001
M.W/Mr.	4493.3
Sequence	[LL-37, 37 aa]

CAT#	Product Name	Inquiry
L07002	LL-37, reverse sequence	Inquiry
L07006	KR-12 (human)	Inquiry
L07005	Biotinyl-LL-37 amide	Inquiry
L07008	LL-37 amide	Inquiry
L07004	Cys-LC-LL-37	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Regulation of secretin on human lower esophageal sphincter

Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...

What is TB 500?

Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...

Function of Abarelix in Advanced Prostate Cancer

Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...

Function of teriparatide in the treatment of osteoporosis

Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...

What is GHK and Copper Peptide?

Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: