CAT# | AF2078 |
Sequence | DLRFLYPRGKLPVPTPPPFNPKPIYIDMGNRY |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...
An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...