CAT# | AF2455 |
Sequence | QAFKTFTPDWNKIRNDAKRMQDNLEQMKKRFNLNL |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...
Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...
Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...
What is palmitoyl hexapeptide-12? Lipopeptides, also known as acylpeptides, consist of a hydrophilic peptide bond and a lipo ...