CAT# | AF3289 |
Sequence | SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL |
Activity | Gram+ & Gram-, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...
An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...