CAT# | AF3006 |
Sequence | KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSSSYHC |
Activity | Gram+, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...
Carnosine (β-alanyl-l-histidine), containing an imidazole moiety, is an intramuscular dipeptide consisting of β ...
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...