Defensin HNP-1 (Human)
Human defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities. HNP-1 reduces adenoviral infection by more than 95%.
Online Inquiry
| CAT# | 10-101-279 |
| CAS | 99287-08-8 |
| Synonyms/Alias | Defensin-1, human; HNP-1 |
| M.F/Formula | C150H228N44O38S6 |
| M.W/Mr. | 3442.03 |
| Sequence | One Letter Code: [CCCCCC]ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Three Letter Code: [Cys2-Cys30, Cys4-Cys19, Cys9-Cys29] Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys |
| Purity | >95% |
| Storage | Store at -20°C. |
Shipping Condition | Shipped at room temperature |
Write a review
Ask a question
My Review for Defensin HNP-1 (Human)
Required fields are marked with *
×
Ask a Question for Defensin HNP-1 (Human)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
