CAT# | C06009 |
M.F/Formula | C151H226N40O45S3 |
M.W/Mr. | 3417.90 |
Sequence | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Linaclotide, sold under the brand name Linzess, is a synthetic tetradecapeptide and guanylate cyclase (GC-C) rec ...
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...
NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...