Amylin, amide, rat
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
Online Inquiry
| CAT# | R1190 |
| CAS | 124447-81-0 |
| Synonyms/Alias | Amylin (rat) |
| M.F/Formula | C₁₆₇H₂₇₂N₅₂O₅₃S₂ |
| M.W/Mr. | 3920.44 |
| Sequence | One Letter Code: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)
three Letter Code: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7) |
Write a review
Ask a question
My Review for Amylin, amide, rat
Required fields are marked with *
×
Ask a Question for Amylin, amide, rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
