Keywords Search Google Search Search

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide.

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1751
M.W/Mr.	3241.70
Sequence	One Letter Code: VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS three Letter Code: Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

CAT#	Product Name	Inquiry
R1909	Pep 2-8	Inquiry
R1276	CEF14, EBV Rta Protein 28-37	Inquiry
R1148	Ac-IEPD-AFC	Inquiry
R1570	Nuclear pore complex protein Nup98 315-360	Inquiry
R0880	PMX 53	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

MEN 11270, a peptide antagonist at the human B2 kinin receptor

MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...

Function of peptide YY (3-36) in ingestion behavior

Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...

Function of KYL Solution on the Cold Preservation of Liver

Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...

The effect of Sincalide on gastric movement

Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...

Function of teriparatide in the treatment of osteoporosis

Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: