CAT# | AF2061 |
Sequence | SISCGESCAMISFCFTEVIGCSCKNKVCYLN |
Activity | Antiviral |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
Glutathione (γ-Glu-Cys-Gly, GSH) is the most abundant antioxidant in animal tissues, at 0.1-10 mM, as well as i ...
Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...