CAT# | AF1937 |
Sequence | GLPVCGETCFGGTCNTPGCSCDPWPMCSRN |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Tetracosactide (also known as Tetracosactide) is a synthetic peptide that is identical to the 24-amino acid segm ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...