CAT# | U02005 |
M.F/Formula | C187H320N56O50 |
M.W/Mr. | 4153.0 |
Sequence | VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
What is Trofinetide? Trofinetide is a neuropeptide synthesized from the breakdown product of insulin-like grow ...
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...
of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...