CAT# | S14002 |
Sequence | ACKGEGVKGCYYEADDWCCKKTPCKCPAWSHERECRCTQPCNPSCR |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
Delmitide, also known as RDP58, is a novel D-amino acid decapeptide with anti-inflammatory effect. RDP58 is a te ...
Aviptadil acetate, the nonproprietary or generic name for a vasoactive intestinal peptide (VIP), is a synthetic ...
Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...
Palmitoyl Pentapeptide, a peptide with significant biological activity, has attracted attention for its anti-aging effect on ...