[Tyr0] Calcitonin Gene Related Peptide II, human
[Tyr0] Calcitonin Gene Related Peptide II, human
Online Inquiry
| CAT# | C05042 |
| CAS | 98824-26-1 |
| M.F/Formula | C162H267N51O48S3 |
| M.W/Mr. | 3793.4 |
| Sequence | One Letter Code: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Cys2 and 7 bridge)
three Letter Code: H-Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (trifluoroacetate salt)(Cys2 and 7 bridge) |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for [Tyr0] Calcitonin Gene Related Peptide II, human
Required fields are marked with *
×
Ask a Question for [Tyr0] Calcitonin Gene Related Peptide II, human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
