Tat-Beclin-1
Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. RELATED PRODUCTS:Beclin-1, Cat# 65466Tat-Beclin-1, scrambled, Cat# 65468
Online Inquiry
| CAT# | GR1214 |
| Sequence | One Letter Code: YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
Three-Letter Code: Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH |
| Purity | % Peak Area By HPLC ≥ 95% |
| Size | 1 mg |
Storage | -20°C |
References | Shoji-Kawata, S. Nature 494, 201-209 (2013); Marquez, RT. Am J Cancer Res 2 (2), 214–221 (2012). |
Write a review
Ask a question
My Review for Tat-Beclin-1
Required fields are marked with *
×
Ask a Question for Tat-Beclin-1
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
