CAT# | T18002 |
Sequence | RCHFVICTTDCRRNSPGTYGECVKKEKGKECVCKS |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...