CAT# | G16003 |
M.F/Formula | C149H225N40O46 |
M.W/Mr. | 3312.7 |
Sequence | SEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...
Linaclotide, sold under the brand name Linzess, is a synthetic tetradecapeptide and guanylate cyclase (GC-C) rec ...
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...
Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...