(Ser8)-GLP-1 (7-36), amide, human

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	G16003
M.F/Formula	C149H225N40O46
M.W/Mr.	3312.7
Sequence	SEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

CAT#	Product Name	Inquiry
G05007	[Des-His1,Glu9] Glucagon	Inquiry
G16005	Glucagon - Like Peptide 1, GLP - 1 (7 - 37)	Inquiry
G16012	(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine)	Inquiry
10-101-46	GLP-1 (7-37) Acetate	Inquiry
G16009	GLP-1/Glucagon-Like Peptide, amide, human	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

What is GHK and Copper Peptide?

Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...

Aclerastide [DSC127] as a Therapy for the Treatment of Diabetic Foot Ulcers

Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...

Function of Psalmotoxin 1 in against pain

Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...

ProTx II, a selective inhibitor of NaV1.7 sodium channel

ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...

Function of myristoyl hexapeptide-4 for improvement of skin

Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: