CAT# | C45002 |
Sequence | TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...
The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
What are copper peptides? Copper peptides are tripeptide molecules composed of three amino acids that combine with copper io ...