Keywords Search Google Search Search

SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide.

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1667
M.W/Mr.	3443.87
Sequence	One Letter Code: SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS three Letter Code: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

CAT#	Product Name	Inquiry
R1048	Acetyl Pepstatin	Inquiry
R2056	Palifermin	Inquiry
R1282	CEF6	Inquiry
HB00044	Biotin-LEED-FMK	Inquiry
R0961	10Panx	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Norleual in Pancreatic Cancer

Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...

Methamphetamine and Substance P

Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...

Atosiban Gives Preterm Labor A Maintenance Treatment

This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...

Inhibition of mast cell tryptase by APC 366

APC 366 [N-(1-hydroxy-2-naphthoyl)-L-arginyl-L-prolinamide], is a novel selective inhibitor of mast cell tryptas ...

An antiplatelet drug of the glycoprotein IIb/IIIa inhibitor class - Eptifibatide Acetate

Eptifibatide acetate is a white or white-off powder, soluble in water and freely soluble in 1% acetic in water, ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: