Keywords Search Google Search Search

Scyllatoxin

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	C27006
M.F/Formula	C142H237N45O39S7
M.W/Mr.	3423.1
Sequence	AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2

CAT#	Product Name	Inquiry
C27012	μ-Conotoxin GIIIA	Inquiry
C27013	μ-Conotoxin GIIIB	Inquiry
C27001	ω-Conotoxin MVIIA	Inquiry
C27004	Alpha-conotoxin GIA	Inquiry
C27010	Biotinyl-EpsilonAhx-Omega-Conotoxin GVIA	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of dynorphin (1-17) in analgesia

In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...

The therapeutic function of DAPTA

DAPTA (D-[Ala]-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-amide), D-Ala-Peptide T amide, is one of analogue of peptide T, which ...

A high affinity blocker for inward-rectifier K+ channels-Tertiapin-Q

Tertiapin-Q (TPN-Q) is a small compact protein that contains twenty-one amino acids, which derived from bee veno ...

Palmitoyl Tripeptide-5

of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...

The Amyloid Precursor Protein and Alzheimer's Disease

The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: