CAT# | C27006 |
M.F/Formula | C142H237N45O39S7 |
M.W/Mr. | 3423.1 |
Sequence | AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...
Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...
The peptide Difopein, designed, isolated and identified by Haian Fu, is a high affinity inhibitor of 14-3-3 pro ...
What are copper peptides? Copper peptides are tripeptide molecules composed of three amino acids that combine with copper io ...
Peptides are compounds formed by linking α-amino acids by peptide bonds, and are intermediate products of proteolysis. They a ...