CAT# | AF2531 |
Sequence | QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSC |
Activity | Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...
Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...
Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...