ProTx-II, an effective and selective NaV1.7 channel blocker, shifts activation gating positively and decreases current magnitude. It blocks action potential propagation in nociceptors.
CAT# | R0894 |
CAS | 484598-36-9 |
Background | ProTx-II (ProTx-2, Protoxin II) is a toxin that was originally isolated from Thrixopelma pruriens (Peruvian green velvet tarantula). ProTx-II inhibits both tetrodotoxin-sensitive and tetrodotoxin-resistant voltage-gated sodium channels. ProTx-II inhibits activation by shifting the voltage-dependence of channel activation to more positive potentials. >> Read More |
M.F/Formula | C168H250N46O41S8 |
M.W/Mr. | 3826.59 |
Sequence | YCQKWMWTCDSERKCCEGMVCRLWCKKKLW(Disulfide bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25) |
Labeling Target | NaV1.7 channel |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Linaclotide, sold under the brand name Linzess, is a synthetic tetradecapeptide and guanylate cyclase (GC-C) rec ...
Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...
Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
Figure 1. Chemical structure of lysipressinLysipressin ([Lys8]-vasopressin) has been identified in the North Ame ...