Keywords Search Google Search Search

protease inhibitor PI-5

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	P15014
Sequence	QVNCTPGTTFQDRCNTCRCSSNGRSAACTLKACPGFG

CAT#	Product Name	Inquiry
P15015	serine protease inhibitor pi-4A	Inquiry
P15004	protease inhibitor PI-7	Inquiry
P15002	PI2	Inquiry
P15005	protease inhibitor PI-8	Inquiry
P15001	PI1	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Histrelin Acetate in Prostate Cancer

Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...

Function of pramlintide in diabetes

Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...

Function of Gonadorelin in Infertility

Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...

Function of myristoyl pentapeptide-11 in skin

Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...

KAI-1678: A novel PKC-epsilon inhibitor

KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: