Prostatic Acid Phosphatase (248 - 286), PAP (248 - 286)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	H09876
M.W/Mr.	4551.5
Sequence	GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY

CAT#	Product Name	Inquiry
H09239	HIV V3 Loop P18 Peptide	Inquiry
H09871	gp120, HIV - 1 MN	Inquiry
H09564	HIV - 1, Envelope Glycoprotein (187 - 203)	Inquiry
H09875	T20	Inquiry
H09003	HIV gag p24 peptide (197 - 205)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of resveratrol in atherosclerosis

Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...

Thyrotropin releasing hormone-protirelin

Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...

Application of ZIP to block the constitutive activity of PKMζ

Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...

What is PT-141?

PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal amide molecu ...

Function of Abarelix in Advanced Prostate Cancer

Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: