Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM. Proadrenomedullin (45-92), human has a longer half-life, is relatively stable and is produced in equimolar amounts to adrenomedullin (ADM), making it a surrogate for plasma levels of ADM gene products.
CAT# | R1629 |
CAS | 166798-69-2 |
M.F/Formula | C₂₁₅H₃₅₉N₆₇O₇₃S₂ |
M.W/Mr. | 5114.76 |
Sequence | One Letter Code: ELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRV three Letter Code: Glu-Leu-Arg-Met-Ser-Ser-Ser-Tyr-Pro-Thr-Gly-Leu-Ala-Asp-Val-Lys-Ala-Gly-Pro-Ala-Gln-Thr-Leu-Ile-Arg-Pro-Gln-Asp-Met-Lys-Gly-Ala-Ser-Arg-Ser-Pro-Glu-Asp-Ser-Ser-Pro-Asp-Ala-Ala-Arg-Ile-Arg-Val |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...
MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...
Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...
L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...
5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...