Preptin, Human Pro-Insulin Growth Factor II (67-100), rat

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	I02007
M.W/Mr.	3932.4
Sequence	DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL

CAT#	Product Name	Inquiry
T08001	Cyclo(-His-Pro)	Inquiry
B1608	Osteocalcin (7-19) (human)	Inquiry
P5801	Preptin (human)	Inquiry
O03004	(Tyr38,Phe42.46)-Osteocalcin (38-49) (human)	Inquiry
A22002	(Pyr-1)-Apelin-13, human, bovine	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Enhanced Binding and Antagonism of Camstatin

Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...

PKC (19-36), a selective PKC peptide inhibitor

PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...

Function of ICI 174,864 in traumatic hemorrhagic shock

ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...

Palmitoyl Tripeptide-1

Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...

HERG-specific Peptide Toxin-BeKm 1

The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: