Preprogalanin 28-67, rat

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	G01018
M.F/Formula	C198H312N62O58
M.W/Mr.	4489.1
Sequence	TKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELP

CAT#	Product Name	Inquiry
G01006	Leptin (57 - 74)	Inquiry
G01016	Galanin Like Peptide (GALP) N - terminal fragment, porcine	Inquiry
G01034	Galanin-Like Peptide (human)	Inquiry
G01029	Galanin (1-13)-Substance P (5-11) amide	Inquiry
G01021	Galanin Like Peptide (GALP), rat	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Amyloid Precursor Protein and Alzheimer's Disease

The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...

Function of Gonadorelin in Infertility

Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...

Function of sinapultide in respiratory distress syndrome

Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...

Effects of L-NMMA Acetate in DOCA-salt Hypertension

NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...

Function of ICI 174,864 in traumatic hemorrhagic shock

ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: