Keywords Search Google Search Search

Pilosulin-1 68->112

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	P25003
Sequence	ILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ

CAT#	Product Name	Inquiry
X04109	PM_11303868	Inquiry
X03753	PM_11043848	Inquiry
X17762	UP_P01301	Inquiry
Q0403	rec Macrophage Inflammatory Protein-1α (human)	Inquiry
X12416	PM_3882423	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Copper peptides: classification, benefits, and mechanism of action

What are copper peptides? Copper peptides are tripeptide molecules composed of three amino acids that combine with copper io ...

Function of propofol in anaesthesia

Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...

Function of Tat-NR2B9c in neuroprotection

The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...

ProTx II, a selective inhibitor of NaV1.7 sodium channel

ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...

Function of romurtide in anti-leukocyte

Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: