Pheromone biosynthesis-activating neuropeptide II

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	P37014
Sequence	LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL

CAT#	Product Name	Inquiry
X02498	PM_10393336	Inquiry
X15675	PM_8982129	Inquiry
X09222	PM_18068154	Inquiry
X14258	PM_8117099	Inquiry
P37027	Pyrokinin-3	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Pharmacological Mechanism and Research Directions of Trofinetide

What is Trofinetide? Trofinetide is a neuropeptide synthesized from the breakdown product of insulin-like grow ...

What is TB 500?

Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...

Function of Timonacic in Cancer

Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...

Function of DAMME in analgesia

DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...

Calcitonin

Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	33
Modifications	Leucine amide