CAT# | P04002 |
M.F/Formula | C190H288N54O57 |
M.W/Mr. | 4240.71 |
Sequence | YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...
PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal amide molecu ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...