Peptide Histidine Isoleucinamide (PHI), Rat (1 - 27)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	G05005
M.W/Mr.	3011.4
Sequence	HADGVFTSDYSRLLGQISAKKYLESLI-NH2

CAT#	Product Name	Inquiry
T09030	Complement C3a Anaphylatoxin (71 - 77), porcine	Inquiry
X04572	PM_11706525	Inquiry
X15028	PM_8596120	Inquiry
X14513	PM_8257439	Inquiry
X11892	PM_2991265	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The medicinal value of cetrorelix acetate

Cetrorelix acetate (C70H92ClN17O14, referred to as cetrorelix), a synthetic decapeptide with 5 amino acids in th ...

Calcitonin

Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...

A novel antiarrhythmic peptide–rotigaptide

Rotigaptide is a novel antiarrhythmic peptide that enhances gap junction (GJ) intercellular conductance between cardiomyocy ...

NK tachykinin receptor selective antagonist-MDL 29,913

In the respiratory tract, there are tachykinin P (SP) and neurokinin A (NKA) in capsaicin-sensitive primary affe ...

What is peptide YY?

The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: