Neuropeptide Y (29-64), amide, human
Neuropeptide Y (29-64), amide, human
Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.
Online Inquiry
| CAT# | R1545 |
| CAS | 90880-35-6 |
| Synonyms/Alias | Human neuropeptide Y (29-64) |
| M.F/Formula | C₁₈₉H₂₈₅N₅₅O₅₇S |
| M.W/Mr. | 4271.68 |
| Sequence | One Letter Code: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
three Letter Code: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
Write a review
Ask a question
My Review for Neuropeptide Y (29-64), amide, human
Required fields are marked with *
×
Ask a Question for Neuropeptide Y (29-64), amide, human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
