CAT# | V02018 |
M.F/Formula | C154H257N49O40S1 |
M.W/Mr. | 3467.1 |
Sequence | KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...
ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...