[Lys1, Pro2,5,Arg3,4,Tyr6] VIP, human, porcine, rat, ovine
[Lys1, Pro2,5,Arg3,4,Tyr6] VIP, human, porcine, rat, ovine
Online Inquiry
| CAT# | V02018 |
| M.F/Formula | C154H257N49O40S1 |
| M.W/Mr. | 3467.1 |
| Sequence | KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2 |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| V02007 |
VIP (11-28), human, porcine, rat, ovine |
|
|
Inquiry |
| V02008 |
VIP (10-28), human, porcine, rat, ovine |
|
|
Inquiry |
| V1313 |
(Ala11.22.28)-VIP (human, mouse, rat) |
|
|
Inquiry |
| V02019 |
VIP (human, porcine, rat) FAM-labeled |
|
|
Inquiry |
| V02010 |
PHM-27/PHI, human |
|
|
Inquiry |
Write a review
Ask a question
My Review for [Lys1, Pro2,5,Arg3,4,Tyr6] VIP, human, porcine, rat, ovine
Required fields are marked with *
×
Ask a Question for [Lys1, Pro2,5,Arg3,4,Tyr6] VIP, human, porcine, rat, ovine
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
