CAT# | A27012 |
Sequence | FYNPRDLVHSGFRPRLCSVSGVEGYPPCVESHSDRKMKNLLDDLFGL |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
What are collagen peptides? Collagen peptides are repair collagen, and the protein slowly decreases with age. It can be see ...
Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...
Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...