CAT# | AF2949 |
Sequence | LRRIARMTPLWRIMNSKPFGAYCQNNYECSTGLCRAGHCSTS |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...
Development of Trofinetide Trofinetide was found in 2002 by Brimble's team at the University of Auckland i ...
Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...