Keywords Search Google Search Search

Lichenicidin

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2157
Sequence	TITLSTCAILSKPLGNNGYLCTVTKECMPSCN
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF1597	CPF-SE1	Inquiry
AF1671	Dermaseptin-H2	Inquiry
AF898	Bactrocerin-1	Inquiry
AF1139	Caerin-4.3	Inquiry
AF1254	Brevinin-1JDa	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of phosphoramidon as an endothelin converting enzyme inhibitor

Phosphoramidon is a kind of thermolysin inhibitor isolated from a culture filtrate of streptomyces. It has prove ...

Pentagastrin functions as diagnostic aids

Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...

Glucagon like peptide-1 (GLP-1)

The history of the discovery and research of GLP-1 (Glucagon like peptide-1) can be traced back to the late 60s to early 70s ...

Function of 10Panx in the pathogenesis of epilepsy

10Panx is a panx 1 mimetic inhibitor that easily and reversibly inhibits panx1 currents. In cells that are diffi ...

What is PT-141?

PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal amide molecu ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: