CAT# | AF2728 |
Sequence | LEEAGSNDTPVAAHQEMSMESWMMPNHIRQKRQSHLSL |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...
What is Trofinetide? Trofinetide is a neuropeptide synthesized from the breakdown product of insulin-like grow ...
Growth hormone releasing factor (GRF) (human) acetate is an acetate salt of an amidated synthetic 29-amino acid ...
Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...