CAT# | I05010 |
Sequence | SRHTGPGNGSGSGAGSGNPFRSPSSQQRPLYYDAPIGKPSKTMYA |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...
PR 39, a porcine 39-aa peptide antibiotic, was originally isolated from the upper part of the small intestine o ...
ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...
What are collagen peptides? Collagen peptides are repair collagen, and the protein slowly decreases with age. It can be see ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...