Growth Hormone Releasing Factor, GRF (1 - 44), amide, human

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	G09008
M.W/Mr.	5039.7
Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARA

CAT#	Product Name	Inquiry
G09021	Acetyl-(Tyr1,D-Phe2)-GRF (1-29) amide (human)	Inquiry
G09020	Acetyl-(Tyr1,D-Arg2)-GRF (1-29) amide (human)	Inquiry
G09004	Growth Hormone Pro-Releasing Factor, human	Inquiry
G09016	(D-Ala2)-GRF (1-29) amide (human)	Inquiry
G09015	(beta-Asp3)-GRF (human)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Gap 19: Specifically block Cx43 hemichannels inhibitor

Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...

Function of NFAT inhibitor

NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...

Guangxitoxin 1E, a potent KV2.1 and KV2.2 channel blocker

Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...

Huwentoxin IV, A Kind of Selective NaV1.7 Channel Blocker

Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...

NK tachykinin receptor selective antagonist-MDL 29,913

In the respiratory tract, there are tachykinin P (SP) and neurokinin A (NKA) in capsaicin-sensitive primary affe ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: