CAT# | G16007 |
M.F/Formula | C166H256N44O56S1 |
M.W/Mr. | 3796.2 |
Sequence | ADGSFSDEMNTILDNLATRDFINWLIQTKITD |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...
DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...