CAT# | G02009 |
M.F/Formula | C226H338N60O66S1 |
M.W/Mr. | 4983.6 |
Sequence | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...
Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...
What is Trofinetide? Trofinetide is a neuropeptide synthesized from the breakdown product of insulin-like grow ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...