CAT# | AF3335 |
Sequence | LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGGIMALIKKYAQKKLWKQLIAA |
Activity | Gram+, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...
What is palmitoyl tripeptide-38? Palmitoyl tripeptide-38 (PT-38), named MATRIXYL synthe'6 and Volulip, a cosmetic peptide or ...
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...