Galanin (1-13)-Spantide I

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	G01011
M.F/Formula	C138H199N35O30
M.W/Mr.	2828.3
Sequence	GWTLNSAGYLLGPDRPKPQQDWFDWLL-NH2

CAT#	Product Name	Inquiry
G01010	Galanin Like Peptide, GALP (41 - 60), human, porcine, rat	Inquiry
G01033	Galanin Message Associated Peptide (44-59) amide	Inquiry
G01029	Galanin (1-13)-Substance P (5-11) amide	Inquiry
G01016	Galanin Like Peptide (GALP) N - terminal fragment, porcine	Inquiry
G01028	Galanin (1-13)-Pro-Pro-(Ala-Leu-)2Ala amide	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of corticotropin in the diagnosis of adrenocortical function

Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...

Function of st-Ht31 in advanced atherosclerotic lesions and cardiovascular disease

st-Ht31, a protein kinase A (PKA)-anchoring inhibitor, greatly induces robust cholesterol or phospholipid effl ...

Overview of tetrapeptide-26

Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...

Novel Peptide Drugs Treat Multiple Diseases (Part One)

Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...

Tachykinin NK2 receptor antagonist-MEN 10376

MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: