CAT# | AF3120 |
Sequence | TMKKSLLLIFFLGTINLSLCQEERNAEEEKRDGDDEMDAEVEKR |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...