CAT# | AF3120 |
Sequence | TMKKSLLLIFFLGTINLSLCQEERNAEEEKRDGDDEMDAEVEKR |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...
Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...