CAT# | F04002 |
Sequence | ETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIA |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...
Dipeptide diaminobutyroyl benzylamide diacetate, often marketed under the name Syn-Ake, is a synthetic peptide that mimics th ...