Exendin 3 (9-39)
Exendin-3 (9-39) is a potent and selecive GLP-1 receptor antagonist.
Online Inquiry
| CAT# | R1827 |
| CAS | 133514-43-9 |
| M.F/Formula | C149H234N40O47S |
| M.W/Mr. | 3369.8 |
| Sequence | One Letter Code: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (Modifications: C-terminal amide)
Three Letter Code: Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser |
| Purity | ≥95% |
| Storage | Store at -20°C for up to 1 year. |
Solubility | Soluble in water. H2O : 50 mg/mL |
Shipping Condition | Room Temperature in continental US; may vary elsewhere |
InChI | InChI=1S/C149H234N40O47S/c1-14-78(10)120(185-139(227)98(62-81-29-16-15-17-30-81)177-136(224)97(61-76(6)7)175-129(217)88(35-24-53-158-149(156)157)172-144(232)119(77(8)9)184-122(210)79(11)164-126(214)90(41-46-114(199)200)168-131(219)91(42-47-115(201)20 |
InChI Key | WSEVKKHALHSUMB-MVNVRWBSSA-N |
Canonical SMILES | CCC(C)C(C(=O)NC(CCC(=O)O)C(=O)NC(CC1=CNC2=CC=CC=C21)C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)NC(CC(=O)N)C(=O)NCC(=O)NCC(=O)N3CCCC3C(=O)NC(CO)C(=O)NC(CO)C(=O)NCC(=O)NC(C)C(=O)N4CCCC4C(=O)N5CCCC5C(=O)N6CCCC6C(=O)NC(CO)C(=O)N)NC(=O)C(CC7=CC=CC=C7)NC(=O)C(CC(C)C)NC(=O)C(CCCNC(=N)N)NC(=O)C(C(C)C)NC(=O)C(C)NC(=O)C(CCC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(CCSC)NC(=O)C(CCC(=O)N)NC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CC(=O)O)N |
Write a review
Ask a question
My Review for Exendin 3 (9-39)
Required fields are marked with *
×
Ask a Question for Exendin 3 (9-39)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
